Invitrogen™ Human TCF3 (aa 73-152) Control Fragment Recombinant Protein

Product Code. 30211445

Brand: Invitrogen™ RP103057

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83978 (PA5-83978. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCF3 (E2A) is a transcription factor that plays major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Heterodimers between E2A and tissue-specific basic helix-loop-helix (bHLH) Dimers bind DNA on E-box motifs: 5'- CANNTG-3'. Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer. Deletions in E2A have been observed in a subset of pre-B-cell acute lymphoblastic leukemia (B-ALL) cases. Two alternatively spliced human isoforms have been described.

Specifications

• Accession Number: P15923
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6929
• Name: Human TCF3 (aa 73-152) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A1; AA408400; AGM8; Alf2; AW209082; bHLHb21; class B basic helix-loop-helix protein 21; E12; E12/E47; E2A; E47; helix-loop-helix protein HE47; immunoglobulin enhancer-binding factor E12/E47; Immunoglobulin transcription factor 1; ITF1; Kappa-E2-binding factor; Me2; MGC129647; MGC129648; negative vitamin D response element-binding protein; NOL1-TCF3 fusion; Pan; Pan1; Pan2; pancreas specific transcription factor 1 c; Ptf1c; TCF3; TCF-3; Tcfe2a; Transcription factor 3; transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47); transcription factor 3 variant 3; transcription factor A1; transcription factor E2a; Transcription factor E2-alpha; transcription factor ITF-1; Transcription regulator Pan; VDIR; VDR interacting repressor; vitamin D receptor-interacting repressor
• Common Name: TCF3
• Gene Symbol: TCF3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining