Invitrogen™ Human TCF2 (aa 23-132) Control Fragment Recombinant Protein

Product Code. 30195167

Brand: Invitrogen™ RP100696

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51682 (PA5-51682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hepatocyte Nuclear Factor 1 (HNF1, Homeoprotein LFB3, Transcription factor 2, TCF2, Variant hepatic nuclear factor) is a member of the homeodomain-containing superfamily of transcription factors. It is a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. HNF1has been shown to function in nephron development and regulates development of the embryonic pancreas. Mutations in the gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of the gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P35680
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6928
• Name: Human TCF2 (aa 23-132) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FJHN; Hepatocyte nuclear factor 1-beta; hepatocyte nuclear factor-1 beta; HNF1 beta A; HNF1 homeobox B; HNF1B; Hnf-1 b; Hnf1beta; HNF-1 Beta; HNF-1-beta; HNF2; homeoprotein LFB3; HPC11; LFB3; LF-B3; MODY5; Tcf2; Tcf-2; Transcription factor 2; Transcription factor 2 hepatic; Transcription factor 2 hepatic; LF-B3; variant hepatic nuclear factor; transcription factor 2, hepatic; Transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor; variant hepatic nuclear factor 1; vHNF1
• Common Name: TCF2
• Gene Symbol: HNF1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining