Invitrogen™ Human TCEAL8 (aa 12-116) Control Fragment Recombinant Protein

Artikelnummer. 30205066

Marke: Invitrogen™ RP92156

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63658 (PA5-63658. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCEAL8 is a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.

Spezifikation

• Accession Number: Q8IYN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90843
• Name: Human TCEAL8 (aa 12-116) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3930402F23Rik; MGC45400; TCEAL8; TCEA-like protein 8; transcription elongation factor A (SII)-like 8; transcription elongation factor A like 8; transcription elongation factor A protein-like 8; Transcription elongation factor S-II protein-like 8; up-regulated in nephrectomized rat kidney #1; UR-NR#1; WEX3
• Common Name: TCEAL8
• Gene Symbol: TCEAL8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining