Invitrogen™ Human TCEAL7 (aa 48-100) Control Fragment Recombinant Protein

Product Code. 30204122

Brand: Invitrogen™ RP101536

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62422 (PA5-62422. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines.

Specifications

• Accession Number: Q9BRU2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56849
• Name: Human TCEAL7 (aa 48-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110018P05Rik; MPMGp800C04260Q003; TCEAL7; TCEA-like protein 7; transcription elongation factor A (SII)-like 7; transcription elongation factor A like 7; transcription elongation factor A protein-like 7; Transcription elongation factor S-II protein-like 7; WEX5
• Common Name: TCEAL7
• Gene Symbol: TCEAL7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining