Invitrogen™ Human TCCR (aa 40-122) Control Fragment Recombinant Protein

Product Code. 30202963

Brand: Invitrogen™ RP109344

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells and type 2 (Th2) cells, which are critical for cell-mediated immunity and most antibody responses, respectively. The differentiation of Th1 cells is predominantly under the influence of IL12, while IL4 influences the differentiation of Th2 cells. Mice deficient in these cytokines, their receptors, or associated transcription factors have impaired, but not absent, Th1 or Th2 immune responses. The gene discussed here encodes a protein that is similar to the mouse T-cell cytokine receptor Tccr at the amino acid level and is predicted to be a glycosylated transmembrane protein. Diseases associated with IL27RA include Hyper Ige Recurrent Infection Syndrome 4 and Crisponi/Cold-Induced Sweating Syndrome 2.

Specifications

• Accession Number: Q6UWB1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9466
• Name: Human TCCR (aa 40-122) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: class I cytokine receptor; CRL1; CRL1IL-27 R; cytokine receptor family, class 1 (WSXWS), member 1; cytokine receptor WSX-1; Cytokine receptor-like 1; il-27 receptor; IL-27 receptor subunit alpha; IL27R; IL-27 R; IL-27 R subunit alpha; IL27RA; IL-27 RA; IL-27 R-alpha; interleukin 27 receptor subunit alpha; interleukin 27 receptor, alpha; interleukin-27 receptor subunit alpha; T cell cytokine receptor; T cell cytokine receptor; cytokine receptor family, class 1 (WSXWS), member 1; TCCR; T-cell cytokine receptor type 1; Type I T-cell cytokine receptor; UNQ296/PRO336; WS x 1; WSX-1; ZcytoR1
• Common Name: TCCR
• Gene Symbol: Il27ra
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining