Invitrogen™ Human TBX15 (aa 370-482) Control Fragment Recombinant Protein

Product Code. 30213113

Brand: Invitrogen™ RP89307

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84106 (PA5-84106. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TBX15 is a probable transcriptional regulator involved in developmental processes.

Specifications

• Accession Number: Q96SF7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6913
• Name: Human TBX15 (aa 370-482) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: T-box 14; T-box 15; T-box protein 14; T-box protein 15; T-box transcription factor TBX14; T-box transcription factor TBX15; TBX14; TBX15
• Common Name: TBX15
• Gene Symbol: TBX15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining