Invitrogen™ Human TBX10 (aa 16-78) Control Fragment Recombinant Protein

Product Code. 30200280

Brand: Invitrogen™ RP109898

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145131 (PA5-145131. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The T-box (Tbx) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The Tbx gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. Tbx genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in Tbx genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of Tbx products has come mainly from the prototypical T/Brachyury, which is a transcription activator.

Specifications

• Accession Number: O75333
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 347853
• Name: Human TBX10 (aa 16-78) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: dancer; Dc; mmTBX7; T-box 10; T-box 10, pseudogene 1; T-box 13; T-box 7; T-box protein 10; T-box protein 13; T-box transcription factor TBX10; T-box-containing transcriptional activator; TBX10; Tbx10-ps1; Tbx13; TBX7
• Common Name: TBX10
• Gene Symbol: TBX10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETYPLPTTSSGWEPRLGSPFPSGPCTSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining