missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210509

Invitrogen™ Human TBRG4 (aa 4-115) Control Fragment Recombinant Protein

Product Code. 30210509
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210509

Brand: Invitrogen™ RP92047

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54236 (PA5-54236. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TBRG4 (transforming growth factor beta regulator 4), also known as CPR2 (cell cycle progression restoration protein 2) or FAST 4 (FAST kinase domain-containing protein 4), is a 631 amino acid protein that contains one RAP domain and belongs to the FAST kinase family. TBRG4 is ubiquitously expressed and may have a role in cell cycle progression. Existing as two alternatively spliced isoforms, the gene encoding TBRG4 maps to human chromosome 7p13.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q969Z0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9238
Name Human TBRG4 (aa 4-115) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310042P22Rik; AA120735; AA408001; AI527316; cell cycle progression 2 protein; cell cycle progression protein 2; Cell cycle progression restoration protein 2; CPR2; FAST 4; FAST kinase domain-containing protein 4; FAST kinase domains 4; FASTKD4; H_TD2522F11.8; KIAA0948; mKIAA0948; Protein TBRG4; R74877; Tb-12; TBRG4; transforming growth factor beta regulated gene 4; transforming growth factor beta regulator 4
Common Name TBRG4
Gene Symbol TBRG4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.