Invitrogen™ Human TBR1 (aa 3-98) Control Fragment Recombinant Protein

Product Code. 30208257

Brand: Invitrogen™ RP106332

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85065 (PA5-85065. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase.

Specifications

• Accession Number: Q16650
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10716
• Name: Human TBR1 (aa 3-98) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: LOW QUALITY PROTEIN: T-box brain protein 1; T-box brain gene 1; T-box brain protein 1; T-box brain transcription factor 1; T-box, brain 1; T-box, brain, 1; T-box, brain, 1-like; TBR1; TBR-1; T-brain-1; TES-56
• Common Name: TBR1
• Gene Symbol: TBR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining