Invitrogen™ Human TBK1 (aa 331-422) Control Fragment Recombinant Protein

Product Code. 30202699

Brand: Invitrogen™ RP106991

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TBK1 serine/threonine kinase is a member of the IKK family and is involved in NF-kappa B activation and IRF3 signaling. TBK1 is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-KB mediates the expression of a great variety of genes in response to extracellular stimuli. NF-KB is associated with IKB proteins in the cell cytoplasm, which inhibit NF-KB activity. Phosphorylation of I-KB by IKB kinase (IKK) complex leads to degradation of I-KB and activation of NF-KB. The IKK complex contains IKKa, IKK beta, and IKKK. A novel IKK related kinase was recently identified and designated TBK1 (TANK-binding kinase 1), NAK (NF-KB-activating kinase), and T2K. NAK/TBK1 activates IKK beta through direct phosphorylation. NAK/TBK1 is activated by growth factors and PMA and mediates IKK and NF-kB activation in response to growth factors. NAK/TBK1 functions upstream of NIK and the IKK complex. NAK/TBK1 is also critical in protecting embryonic liver from apoptosis.

Specifications

• Accession Number: Q9UHD2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29110
• Name: Human TBK1 (aa 331-422) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200008B05Rik; AI462036; AW048562; FLJ11330; FTDALS4; NAK; NF-kappa-B-activating kinase; NF-kB-activating kinase; serine/threonine protein kinase TBK1; serine/threonine-protein kinase TBK1; T2K; TANK binding kinase 1; TANK-binding kinase 1; tbk; TBK1
• Common Name: TBK1
• Gene Symbol: TBK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining