Invitrogen™ Human TBCEL (aa 3-100) Control Fragment Recombinant Protein

Product Code. 30199206

Brand: Invitrogen™ RP97395

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58456 (PA5-58456. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a regulator of tubulin stability.

Specifications

• Accession Number: Q5QJ74
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 219899
• Name: Human TBCEL (aa 3-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: catastrophin; D330014K23; E130107N23Rik; El; E-like; leucine rich repeat containing 35; leucine-rich repeat-containing protein 35; Lrrc35; RGD1308880; Tbcel; tubulin folding cofactor E like; tubulin folding cofactor E-like; tubulin-specific chaperone cofactor E-like protein; tubulin-specific chaperone e-like
• Common Name: TBCEL
• Gene Symbol: TBCEL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining