Invitrogen™ Human TBC1D2 (aa 406-485) Control Fragment Recombinant Protein

Product Code. 30213157

Brand: Invitrogen™ RP92894

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56577 (PA5-56577. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as GTPase-activating protein for RAB7A. Signal effector acting as a linker between RAC1 and RAB7A, leading to RAB7A inactivation and subsequent inhibition of cadherin degradation and reduced cell-cell adhesion.

Specifications

• Accession Number: Q9BYX2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55357
• Name: Human TBC1D2 (aa 406-485) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A630005A06Rik; armus; BC022630; BC1D2; Gm1037; likely ortholog of H. sapiens TBC1 domain family, member 2 (TBC1D2); PARIS1; PARIS-1; PP8997; Prostate antigen recognized and identified by SEREX 1; TBC1 domain family member 2; TBC1 domain family member 2 A; TBC1 domain family, member 2; TBC1 domain family, member 2 A; TBC1D2; TBC1D2A
• Common Name: TBC1D2
• Gene Symbol: TBC1D2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLMDKNHAKQQVICKLSEKVTQDFTHPPDQSPLRPDAANRDFLSQQGKIEHLKDDMEAYRTQNCFLNSEIHQVTKIWRKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining