missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213203

Invitrogen™ Human TBC1D10A (aa 92-242) Control Fragment Recombinant Protein

Product Code. 30213203
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213203

Brand: Invitrogen™ RP91346

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-82312 (PA5-82312, PA5-52517 (PA5-52517. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as GTPase-activating protein for RAB27A, but not for RAB2A, RAB3A, nor RAB4A. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BXI6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83874
Name Human TBC1D10A (aa 92-242) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AC004997.C22.2; AI447804; dJ130H16.1; dJ130H16.2; EBP50-PDX interactor of 64 kDa; EBP50-PDZ interactor of 64 kD; EPI64; EPI64 protein; mFLJ00288; Rab27A-GAP-alpha; TBC1 domain family member 10 A; TBC1 domain family, member 10 A; TBC1D10; Tbc1d10a
Common Name TBC1D10A
Gene Symbol TBC1D10A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NWDKWMAKKHKKIRLRCQKGIPPSLRGRAWQYLSGGKVKLQQNPGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQICEKYLPGYYSEKLEAIQLDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.