Invitrogen™ Human TAS1R1 (aa 189-297) Control Fragment Recombinant Protein

Product Code. 30212155

Brand: Invitrogen™ RP95323

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate) and also to most of the 20 standard L-amino acids, but not to their D-enantiomers or other compounds. Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses. Expressed strongly only in fungiform papillae.

Specifications

• Accession Number: Q7RTX1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80835
• Name: Human TAS1R1 (aa 189-297) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: candidate taste receptor T1R1; G protein-coupled receptor 70; GM148; GPCRB3; GPCR-B3; GPR70; G-protein coupled receptor 70; seven transmembrane helix receptor; T1r1; TAS1R1; taste 1 receptor member 1; taste receptor type 1 member 1; taste receptor, type 1, member 1; TR1; TS1R1
• Common Name: TAS1R1
• Gene Symbol: TAS1R1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIAFKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLTNLTGKVW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining