Invitrogen™ Human TAPP1 (aa 113-188) Control Fragment Recombinant Protein

Product Code. 30194792

Brand: Invitrogen™ RP107371

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66719 (PA5-66719. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Binds specifically to phosphatidylinositol 3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. May recruit other proteins to the plasma membrane.

Specifications

• Accession Number: Q9HB21
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 59338
• Name: Human TAPP1 (aa 113-188) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA960558; C920009D07Rik; PH domain-containing family A member 1; pleckstrin homology domain containing A1; pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1; pleckstrin homology domain-containing family A member 1; pleckstrin homology domain-containing protein family A member 1; PLEKHA1; RGD1564153; tandem PH domain containing protein-1; tandem PH domain-containing protein 1; TAPP1; TAPP-1
• Common Name: TAPP1
• Gene Symbol: PLEKHA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining