Invitrogen™ Human TANC1 (aa 1491-1574) Control Fragment Recombinant Protein

Product Code. 30194866

Brand: Invitrogen™ RP96006

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57797 (PA5-57797. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TANC1 (Tetratricopeptide repeat, ankyrin repeat and coiled-coil domain-containing protein 1) is a PSD-95-interacting synaptic protein that is proposed to play a role in the regulation of dendritic spines and excitatory synapses and spatial memory.

Specifications

• Accession Number: Q9C0D5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85461
• Name: Human TANC1 (aa 1491-1574) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200003E16Rik; KIAA1728; mKIAA1728; Protein TANC1; rolling pebbles homolog B; ROLSB; Tanc; TANC1; tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1; tetratricopeptide repeat, ankyrin repeat and coiled-coil domain-containing protein 1; TPR domain, ankyrin-repeat and coiled-coil domain-containing protein 1; TPR domain, ankyrin-repeat and coiled-coil-containing; TPR domain, ankyrin-repeat and coiled-coil-containing protein
• Common Name: TANC1
• Gene Symbol: TANC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQEGLQSKGRPVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQNPPPSPMPGRIAATP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining