missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193903

Invitrogen™ Human TAIP12 (aa 260-348) Control Fragment Recombinant Protein

Product Code. 30193903
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193903

Brand: Invitrogen™ RP92021

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53822 (PA5-53822. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H175
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81566
Name Human TAIP12 (aa 260-348) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC035295; C12orf2; C12orf22; Csnrp2; CSRN2; Csrnp2; CSRNP-2; cysteine and serine rich nuclear protein 2; cysteine/serine-rich nuclear protein 2; cysteine-serine-rich nuclear protein 2; Fam130a1; family with sequence similarity 130, member A1; FLJ25576; PPP1R72; Protein FAM130A1; protein phosphatase 1, regulatory subunit 72; RGD1308916; TAIP12; TAIP-12; TGF-beta induced apoptosis protein 12; TGF-beta-induced apoptosis protein 12
Common Name TAIP12
Gene Symbol Csrnp2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.