missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TAF8 (aa 85-154) Control Fragment Recombinant Protein

Product Code. 30199619
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199619

Brand: Invitrogen™ RP102602

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56838 (PA5-56838. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. Mediates both basal and activator-dependent transcription. Plays a role in the differentiation of preadipocyte fibroblasts to adipocytes, however, does not seem to play a role in differentiation of myoblasts. Required for the integration of TAF10 in the TAF complex. May be important for survival of cells of the inner cell mass which constitute the pluripotent cell population of the early embryo.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z7C8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 129685
Name Human TAF8 (aa 85-154) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW260255; hTAFII43; II; Protein taube nuss; Protein taube nuss-like; similar to taube nuss; TAF; TAF(II)43; TAF8; TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43 kDa; TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factorq; TAFII43; TAFII-43; TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50 kDa; TATA box binding protein associated factor 8; TATA-box binding protein associated factor 8; taube nuss; taube nuss homolog; TBN; tbnl; tbnl protein; TBP-associated factor 43 kDa; TBP-associated factor 8; TBP-associated factor TAFII43; TBP-associated factor, RNA polymerase II, 43 kD; transcription initiation factor TFIID 43 kDa subunit; Transcription initiation factor TFIID subunit 8; zgc:56401; zgc:77837
Common Name TAF8
Gene Symbol TAF8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.