Invitrogen™ Human TAF7L (aa 89-231) Control Fragment Recombinant Protein

Product Code. 30196927

Brand: Invitrogen™ RP92124

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51650 (PA5-51650. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May play a role in spermatogenesis.

Specifications

• Accession Number: Q5H9L4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54457
• Name: Human TAF7L (aa 89-231) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933438I11Rik; 50 kDa; cancer/testis antigen 40; CT40; RGD1564898; RNA polymerase II TBP-associated factor subunit Q; TAF2Q; Taf7l; TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50 kDa; TATA box binding protein (TBP)-associated factor, RNA polymerase II, Q; TATA box binding protein associated factor 7 like; TATA box binding protein-associated factor RNA polymerase II subunit Q; TATA box-binding protein-associated factor 50 kDa; TATA-box binding protein associated factor 7 like; TBP-associated factor, RNA polymerase II, Q; transcription initiation factor TFIID 50 kDa subunit; Transcription initiation factor TFIID subunit 7-like
• Common Name: TAF7L
• Gene Symbol: TAF7L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining