Invitrogen™ Human TAF6L (aa 304-384) Control Fragment Recombinant Protein

Product Code. 30200399

Brand: Invitrogen™ RP103650

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64316 (PA5-64316. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In eukaryotic systems, the process of initiating transcription from protein-coding genes requires the presence of RNA polymerase II and a broad family of auxiliary transcription factors. TFIID is a general transcription factor that initiates preinitiation complex assembly through direct interaction with the TATA promoter element. Functioning as a multisubunit complex consisting of a small TATA-binding polypeptide and other TBP-associated factors (TAFs), TFIID mediates promoter responses to various transcriptional activators and repressors. TAF6L, also known as PAF65A, is a 622 amino acid nuclear protein that functions as part of the PCAF (p300/CBP-associated factor) histone acetylase complex.

Specifications

• Accession Number: Q9Y6J9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10629
• Name: Human TAF6L (aa 304-384) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810417N14Rik; BB223262; C530024J06Rik; fa05b10; p300/CBP-associated factor (PCAF)-associated factor 65; Paf65a; PAF65-alpha; PCAF-associated factor 65 alpha; PCAF-associated factor 65-alpha; TAF6L; TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6 L; TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor; TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65 kDa; TATA box binding protein associated factor 6 like; TATA-box binding protein associated factor 6 like; wu:fa05b10
• Common Name: TAF6L
• Gene Symbol: TAF6L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining