Invitrogen™ Human TAF6 (aa 114-251) Control Fragment Recombinant Protein

Product Code. 30205151

Brand: Invitrogen™ RP89319

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52310 (PA5-52310. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Four isoforms have been identified but complete transcripts have been determined for only three isoforms. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.

Specifications

• Accession Number: P49848
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6878
• Name: Human TAF6 (aa 114-251) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 80 kDa; AW549759; DKFZp781E21155; MGC:8964; p80; RNA polymerase II TBP-associated factor subunit E; RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80 kDa; TAF(II)70; TAF(II)80; TAF2E; Taf6; TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80 kDa; TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80 kDa; TAFII70; TAFII-70; TAFII80; TAFII-80; TAFII85; TATA box binding protein (Tbp)-associated factor, RNA polymerase II, E; TATA box binding protein (TBP)-associated factor, RNA polymerase II, E, 70/85 kD; TATA box binding protein associated factor 6; TATA-box binding protein associated factor 6; TBP-associated factor 6; TBP-associated factor 6 isoform alpha; TFIID subunit p80; transcription initiation factor TFIID 70 kDa subunit; Transcription initiation factor TFIID 80 kDa subunit; transcription initiation factor TFIID subunit 6; wu:fb83e08; wu:fj30b02; zgc:92160
• Common Name: TAF6
• Gene Symbol: TAF6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining