Invitrogen™ Human TAF10 (aa 93-214) Control Fragment Recombinant Protein

Product Code. 30212449

Brand: Invitrogen™ RP102285

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52062 (PA5-52062. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs.

Specifications

• Accession Number: Q12962
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6881
• Name: Human TAF10 (aa 93-214) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 30 kDa; AU041226; im:6899389; mTAFII30; si:dkey-72l14.8; STAF28; TAF(II)30; TAF10; TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kDa; TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kDa; TAF2A; Taf2h; TAFII30; TAFII-30; TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30 kDa; TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30 kD; TATA box binding protein associated factor 10; TATA-box binding protein associated factor 10; TBP-related factor 10; transcription initiation factor TFIID 30 kD subunit; transcription initiation factor TFIID 30 kDa subunit; Transcription initiation factor TFIID subunit 10
• Common Name: TAF10
• Gene Symbol: TAF10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining