missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TAF10 (aa 93-214) Control Fragment Recombinant Protein

Product Code. 30212449
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212449

Brand: Invitrogen™ RP102285

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52062 (PA5-52062. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12962
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6881
Name Human TAF10 (aa 93-214) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 30 kDa; AU041226; im:6899389; mTAFII30; si:dkey-72l14.8; STAF28; TAF(II)30; TAF10; TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kDa; TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kDa; TAF2A; Taf2h; TAFII30; TAFII-30; TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30 kDa; TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30 kD; TATA box binding protein associated factor 10; TATA-box binding protein associated factor 10; TBP-related factor 10; transcription initiation factor TFIID 30 kD subunit; transcription initiation factor TFIID 30 kDa subunit; Transcription initiation factor TFIID subunit 10
Common Name TAF10
Gene Symbol TAF10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.