Invitrogen™ Human TADA3L (aa 370-432) Control Fragment Recombinant Protein

Product Code. 30202132

Brand: Invitrogen™ RP89403

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83596 (PA5-83596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined.

Specifications

• Accession Number: O75528
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10474
• Name: Human TADA3L (aa 370-432) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110004B19Rik; ADA3; ADA3 homolog; ADA3-like protein; AI987856; alteration/deficiency in activation 3; fa03f04; FLJ20221; FLJ21329; hADA3; mADA3; NGG1; STAF54; Tada3; Tada3l; Transcriptional adapter 3; transcriptional adapter 3-like; transcriptional adaptor 3; transcriptional adaptor 3 (NGG1 homolog, yeast)-like; transcriptional adaptor 3-like isoform b; Unknown (protein for MGC:133915); wu:fa03f04; zgc:63596
• Common Name: TADA3L
• Gene Symbol: TADA3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining