Invitrogen™ Human TACC1 (aa 226-307) Control Fragment Recombinant Protein

Product Code. 30194478

Brand: Invitrogen™ RP108933

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O75410
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6867
• Name: Human TACC1 (aa 226-307) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833447E04Rik; AA960202; B230378H13Rik; Ga55; gastric cancer antigen Ga55; KIAA1103; Tacc1; Tacc1a; Taxin-1; transforming acidic coiled-coil containing protein 1; transforming acidic coiled-coil-containing protein 1; transforming, acidic coiled-coil containing protein 1; transforming, acidic coiled-coil containing protein 1 A
• Common Name: TACC1
• Gene Symbol: TACC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining