missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TAB3 (aa 417-513) Control Fragment Recombinant Protein

Product Code. 30195242
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195242 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195242 Supplier Invitrogen™ Supplier No. RP95454

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57100 (PA5-57100. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAB3 functions in the NF-kappaB signal transduction pathway. It and the similar and functionally redundant protein TAB2, form a ternary complex with the protein kinase TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. Recent experiments have shown that TAB2 and the related protein TAB3 constitutitvely interact with the autophagy mediator Beclin-1; upon induction of autophagy, these proteins dissociate from Beclin-1 and bind TAK1. Overexpression of TAB2 and TAB3 inhibit autophagy, while their depletion triggers it, suggesting that TAB2 and TAB3 act as a control point for autophagy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N5C8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 257397
Name Human TAB3 (aa 417-513) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921526G09Rik; Kiaa4135; MAP3K7IP3; mitogen activated protein kinase kinase kinase 7 interacting protein 3; mitogen-activated protein kinase kinase kinase 7 interacting protein 3; mitogen-activated protein kinase kinase kinase 7-interacting protein 3; mKIAA4135; NAP1; NF-kappa-B-activating protein 1; NFkB activating protein 1; Tab3; TAB-3; TAK1-binding protein 3; TGF-beta activated kinase 1 (MAP3K7) binding protein 3; TGF-beta activated kinase 1 and MAP3K7 binding protein 3; TGF-beta activated kinase 1/MAP3K7 binding protein 3; TGF-beta-activated kinase 1 and MAP3K7-binding protein 3; TGF-beta-activated kinase 1-binding protein 3
Common Name TAB3
Gene Symbol Tab3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.