Invitrogen™ Human SYT16 (aa 444-592) Control Fragment Recombinant Protein

Product Code. 30202574

Brand: Invitrogen™ RP88932

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52072 (PA5-52072. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SYT16 is a protein coding gene. May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Is Ca(2+)-independent.

Specifications

• Accession Number: Q17RD7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83851
• Name: Human SYT16 (aa 444-592) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: chr14 synaptotagmin; CHR14SYT; CTD-2277K2.1; STREP14; Synaptotagmin 14-like protein; synaptotagmin 16; synaptotagmin XIV-related protein; synaptotagmin XVI; synaptotagmin-16; SYT14L; syt14r; SYT16; yt14r
• Common Name: SYT16
• Gene Symbol: SYT16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining