Invitrogen™ Human SYT15 (aa 209-273) Control Fragment Recombinant Protein

Product Code. 30203488

Brand: Invitrogen™ RP105645

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66691 (PA5-66691. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues.

Specifications

• Accession Number: Q9BQS2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83849
• Name: Human SYT15 (aa 209-273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: chr10 synaptotagmin; CHR10SYT; synaptotagmin 15; synaptotagmin XV; synaptotagmin XV-a; synaptotagmin-15; SYT15; SytXV
• Common Name: SYT15
• Gene Symbol: SYT15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining