Invitrogen™ Human SYS1 (aa 36-67) Control Fragment Recombinant Protein

Product Code. 30181280

Brand: Invitrogen™ RP99474

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in protein trafficking. May serve as a receptor for ARFRP1.

Specifications

• Accession Number: Q8N2H4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90196
• Name: Human SYS1 (aa 36-67) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C20orf169; dJ453C12.4; dJ453C12.4.1; Protein SYS1 homolog; SYS1; Sys1 golgi trafficking protein; SYS1 Golgi-localized integral membrane protein homolog
• Common Name: SYS1
• Gene Symbol: SYS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining