Invitrogen™ Human SYPL1 (aa 181-210) Control Fragment Recombinant Protein

Product Code. 30206853

Brand: Invitrogen™ RP90694

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53126 (PA5-53126. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The synaptophysin-like protein 1, also known as pantophysin, is a homolog of the neuroendocrine-specific protein synaptophysin, with the highest level of homology across its four transmembrane domains. Unlike synaptophysin however, SYPL1 is ubiquitously expressed and found in small cytoplasmic transport vesicles regardless of their content. SYPL1 is thought to play a multifunctional role in vesicle biogenesis and transport and is a component of adipocyte transport vesicles, and thus may be involved in adipocyte secretion. SYPL1 also interacts with vesicle-associated membrane protein 2 (VAMP-2) in adipocytes and associates with GLUT4-containing vesicles.

Specifications

• Accession Number: Q16563
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6856
• Name: Human SYPL1 (aa 181-210) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI314763; AI604763; D12Ertd446e; H-SP1; Pan I; PanI; Pantophysin; Pphn; synaptophysin like 1; synaptophysin-like 1; synaptophysin-like protein; synaptophysin-like protein 1; SYPL; Sypl1
• Common Name: SYPL1
• Gene Symbol: SYPL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATGHNIIDELPPCKKKAVLCYFGSVTSMGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining