missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204695

Invitrogen™ Human SYNPO2L (aa 214-286) Control Fragment Recombinant Protein

Product Code. 30204695
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204695

Brand: Invitrogen™ RP101447

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63082 (PA5-63082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SYNPO2L was initially identified as a novel heart-enriched gene that encodes a cytoskeletal protein highly expressed in the Z-disc of heart and skeletal muscle, associates with actin and interacts with a-actinin. It is a member of the synaptopodin family, sharing greatest homology with Synaptopodin 2. Recent studies have shown that SYNPO2L, while primarily localized to the sarcomere, can also translocate to the nucleus. A knockdown of SYNPO2L in zebrafish resulted in aberrant cardiac and skeletal muscle development and function, suggesting that it is a critical component of the sarcomere and plays an important role in muscle development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H987
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79933
Name Human SYNPO2L (aa 214-286) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110054M18Rik; Chap; RGD1565434; synaptopodin 2 like; synaptopodin 2-like; synaptopodin 2-like protein; SYNPO2L
Common Name SYNPO2L
Gene Symbol SYNPO2L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PAEALLLPHGPLRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.