Invitrogen™ Human Synip Control Fragment Recombinant Protein

Product Code. 30205343

Brand: Invitrogen™ RP93360

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54629 (PA5-54629. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STXBP4 plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. STXBP4 inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. STXBP4 may also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.

Specifications

• Accession Number: Q6ZWJ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 252983
• Name: Human Synip Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6030470M02Rik; FLJ16496; MGC149829; MGC50337; ST x 4-interacting protein; Stxbp4; Synip; syntaxin 4 interacting protein; syntaxin 4-interacting protein; syntaxin binding protein 4; syntaxin-binding protein 4
• Common Name: Synip
• Gene Symbol: Stxbp4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALHSRIHLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining