missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198775

Invitrogen™ Human SYNGR2 (aa 168-220) Control Fragment Recombinant Protein

Product Code. 30198775
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198775

Brand: Invitrogen™ RP91138

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110794 (PA5-110794. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synaptogyrins comprise a family of tyrosine-phosphorylated membrane proteins with two neuronal (SYNGR1 and SYNGR3) and one ubiquitous (SYNGR2) members. SYNGR1 and -3 are synaptic vesicle proteins, residing in some cases on the same synaptic vesicle, and are thought to be involved in the regulation of neurotransmitter release. SYNGR2, by contrast, is absent from synaptic vesicles. The role and localization of a fourth synaptogyrin, SYNGR4, is unclear. SYNGR3 is predominantly expressed in brain and placenta. The exact function of SYNGR2 is unknown, but studies suggest that it may play a role in regulating membrane traffic in non-neuronal cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43760
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9144
Name Human SYNGR2 (aa 168-220) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cellugyrin; Clast2; MGC102914; synaptogyrin 2; synaptogyrin-2; Syngr2; UNQ352/PRO615
Common Name SYNGR2
Gene Symbol SYNGR2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.