Invitrogen™ Human SynGAP (aa 325-407) Control Fragment Recombinant Protein

Product Code. 30198643

Brand: Invitrogen™ RP95040

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58362 (PA5-58362. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synaptic Ras-GTPase activating protein (SynGAP) is a PDZ-domain interacting protein expressed almost exclusively in the brain. SynGAP has been shown to be a major component of postsynaptic density and associates with post synaptic density 95 kDa (PSD-95), a synaptic scaffold protein, and synaptic N-methyl-D-aspartate (NMDA) receptors. SynGAP Ras-GTPase activity has also been shown to be inhibited by phosphorylation by CaM kinase II, another abundant protein located in the postsynaptic density. It has been proposed that SynGAP may function as a negative regulator of MAP Kinase activation in the absence of active NMDA receptors.

Specifications

• Accession Number: Q96PV0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8831
• Name: Human SynGAP (aa 325-407) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DKFZp761G1421; Gm1963; KIAA1938; MRD5; Neuronal R; Neuronal RasGAP; OTTHUMP00000209046; p135 SynGAP; Ras GTPase-activating protein SynGAP; ras/Rap GTPase-activating protein SynGAP; RASA1; RASA5; synaptic Ras GTPase activating protein 1; synaptic Ras GTPase activating protein 1 homolog; synaptic Ras GTPase activating protein 1 homolog (rat); synaptic Ras GTPase activating protein, 135 kDa; synaptic Ras GTPase-activating protein 1; Synaptic Ras-GAP 1; SYNGAP; Syngap1
• Common Name: SynGAP
• Gene Symbol: SYNGAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining