missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210412

Invitrogen™ Human Syndecan 4 (aa 29-146) Control Fragment Recombinant Protein

Product Code. 30210412
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210412

Brand: Invitrogen™ RP101010

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Syndecans are type I integral membrane proteoglycans that are involved in cell-extracellular matrix adhesion and growth factor binding. Syndecan 1 is a matrix receptor which binds to Collagens, Fibronectin and Thrombospondin. Syndecan 1 and Syndecan 3 interact with MK (midkine), a growth/differentiation factor involved in embryogenesis. Syndecan 2 is highly expressed at areas of high morphogenetic activity, such as epithelial-mesenchymal interfaces and the prechondrogenic and preosteogenic mesenchymal condensations. Syndecan 4 functions cooperatively with integrins in the processes of cell spreading and focal adhesion assembly.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P31431
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6385
Name Human Syndecan 4 (aa 29-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA959608; Amphiglycan; AW108331; MGC22217; RATRYUDOCA; RYUDOCA; ryudocan; ryudocan amphiglycan; ryudocan core protein; Ryudocan/syndecan 4; S4; SDC4; Synd4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan proteoglycan 4; syndecan-4
Common Name Syndecan 4
Gene Symbol Sdc4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.