Invitrogen™ Human Synaptojanin 1 (aa 923-1053) Control Fragment Recombinant Protein

Product Code. 30211698

Brand: Invitrogen™ RP89906

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82442 (PA5-82442. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.

Specifications

• Accession Number: O43426
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8867
• Name: Human Synaptojanin 1 (aa 923-1053) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930006D20Rik; AA675315; inositol 5'-phosphatase (synaptojanin 1); inositol polyphosphate-5-phosphatase G; INPP5G; KIAA0910; mKIAA0910; PARK20; phosphoinositide 5-phosphatase; synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1; synaptic inositol-1; synaptic inositol-1,4,5-trisphosphate 5-phosphatase 1; synaptojanin 1; synaptojanin-1; synaptojanin-1, polyphosphoinositide phosphatase; Synj1
• Common Name: Synaptojanin 1
• Gene Symbol: SYNJ1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining