Invitrogen™ Human SYF2 (aa 2-92) Control Fragment Recombinant Protein

Product Code. 30205494

Brand: Invitrogen™ RP90735

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82622 (PA5-82622. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Specifications

• Accession Number: O95926
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25949
• Name: Human SYF2 (aa 2-92) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110018L13Rik; Cbpin; CCNDBP1 interactor; CCNDBP1-interactor; D4Bwg1551e; DKFZP564O2082; fSAP29; functional spliceosome-associated protein 29; GCIP-interacting protein p29; GCIP-interacting protein p29 (Gcipip); Gcipip; mp29; Ntc31; P29; Pre-mRNA-splicing factor SYF2; SYF2; SYF2 homolog, RNA splicing factor; SYF2 homolog, RNA splicing factor (S. cerevisiae); SYF2 pre-mRNA splicing factor; SYF2 pre-mRNA-splicing factor
• Common Name: SYF2
• Gene Symbol: SYF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining