missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SUV420H1 (aa 651-721) Control Fragment Recombinant Protein

Product Code. 30204912
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204912

Brand: Invitrogen™ RP107271

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66611 (PA5-66611. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. KMT5B is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Plays a role in myogenesis by regulating the expression of target genes, such as EID3.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q4FZB7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51111
Name Human SUV420H1 (aa 651-721) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias [histone H4]-lysine20 N-methyltransferase KMT5B; [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B; AA117471; C630029K18Rik; CGI85; CGI-85; histone-lysine N-methyltransferase KMT5B; histone-lysine N-methyltransferase SUV420H1; Kmt5b; lysine (K)-specific methyltransferase 5 B; lysine methyltransferase 5 B; lysine N-methyltransferase 5 B; Lysine-specific methyltransferase 5 B; MGC118906; MGC118909; MGC21161; MGC703; si:dkey-12e7.2; Su(var)4-20 homolog 1; suppressor of variegation 4-20 homolog 1; suppressor of variegation 4-20 homolog 1 (Drosophila); suppressor of variegation 4-20 protein-like 1; SUV420; SUV420H1; suv4-20h1; Unknown (protein for MGC:137299); wu:fb97g06; wu:fi57g03; zgc:103527
Common Name SUV420H1
Gene Symbol KMT5B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.