Invitrogen™ Human SUV420H1 (aa 651-721) Control Fragment Recombinant Protein

Product Code. 30204912

Brand: Invitrogen™ RP107271

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66611 (PA5-66611. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. KMT5B is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Plays a role in myogenesis by regulating the expression of target genes, such as EID3.

Specifications

• Accession Number: Q4FZB7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51111
• Name: Human SUV420H1 (aa 651-721) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: [histone H4]-lysine20 N-methyltransferase KMT5B; [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B; AA117471; C630029K18Rik; CGI85; CGI-85; histone-lysine N-methyltransferase KMT5B; histone-lysine N-methyltransferase SUV420H1; Kmt5b; lysine (K)-specific methyltransferase 5 B; lysine methyltransferase 5 B; lysine N-methyltransferase 5 B; Lysine-specific methyltransferase 5 B; MGC118906; MGC118909; MGC21161; MGC703; si:dkey-12e7.2; Su(var)4-20 homolog 1; suppressor of variegation 4-20 homolog 1; suppressor of variegation 4-20 homolog 1 (Drosophila); suppressor of variegation 4-20 protein-like 1; SUV420; SUV420H1; suv4-20h1; Unknown (protein for MGC:137299); wu:fb97g06; wu:fi57g03; zgc:103527
• Common Name: SUV420H1
• Gene Symbol: KMT5B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining