Invitrogen™ Human SUPT16H (aa 187-282) Control Fragment Recombinant Protein

Product Code. 30194397

Brand: Invitrogen™ RP103053

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62045 (PA5-62045. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT, interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit.

Specifications

• Accession Number: Q9Y5B9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11198
• Name: Human SUPT16H (aa 187-282) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cdc68; Chromatin-specific transcription elongation factor 140 kDa subunit; chromatin-specific transcription elongation factor large subunit; DNA unwinding factor 140 kDa subunit; DUF140; facilitates chromatin remodeling 140 kDa subunit; facilitates chromatin transcription complex subunit spt16; FACT; FACT 140 kDa subunit; FACT complex subunit SPT16; FACT complex subunit SPT16-like protein; FACT140; Factp140; FLJ10857; FLJ14010; FLJ34357; fq44d08; HGNC:11465; hSPT16; SPT16; SPT16 homolog, facilitates chromatin remodeling subunit; SPT16/CDC68; suppressor of Ty 16; suppressor of Ty 16 homolog; suppressor of Ty 16 homolog (S. cerevisiae); Supt16; supt16h; wu:fq44d08; zgc:194708; zgc:194732
• Common Name: SUPT16H
• Gene Symbol: SUPT16H
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining