Invitrogen™ Human SUMO2 (aa 17-48) Control Fragment Recombinant Protein

Product Code. 30204711

Brand: Invitrogen™ RP104436

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111266 (PA5-111266. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SUMO2 is a member of the SUMO (small ubiquitin-like modifier) protein family. This protein family functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. In vertebrates, three members of the SUMO family have been described, SUMO 1 and the functionally distinct homologues SUMO 2 and SUMO 3. SUMO modification sites present in the N terminal regions of SUMO 2 and SUMO 3 are utilized by SAE1/SAE2 (SUMO E1) and Ubc9 (SUMO E2) to form polymeric chains of SUMO 2 and SUMO 3 on protein substrates, a property not shared by SUMO 1.

Specifications

• Accession Number: P61956
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6613
• Name: Human SUMO2 (aa 17-48) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HSMT3; sentrin 2; sentrin-2; small ubiquitin-like modifier 2; small ubiquitin-like modifier 2 L homeolog; small ubiquitin-like modifier 3; small ubiquitin-related modifier 2; Small ubiquitin-related modifier 2-A; small ubiquitin-related modifier 3; SMT3 homolog 1; SMT3 homolog 2; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 2 (yeast); SMT3 suppressor of mif two 3 homolog 3; SMT3 supressor of mif two 3 homolog 2; Smt3A; Smt3b; SMT3H1; SMT3H2; Sumo2; SUMO-2; sumo2.L; SUMO-2-A; sumo2-a; sumo2-b; SUMO3; SUMO-3; Ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; XELAEV_18044053mg
• Common Name: SUMO2
• Gene Symbol: SUMO2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining