Invitrogen™ Human SUMF1 (aa 126-201) Control Fragment Recombinant Protein

Product Code. 30204409

Brand: Invitrogen™ RP96345

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58213 (PA5-58213. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q8NBK3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285362
• Name: Human SUMF1 (aa 126-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA543204; AAPA3037; AI463102; AI851573; C-alpha-formylglycine-generating enzyme 1; Fge; FGly-generating enzyme; Formylglycine-generating enzyme; MGC131853; MGC150436; OTTHUMP00000115300; PSEC0152; sulfatase modifying factor 1; sulfatase-modifying factor 1; SUMF1; UNQ3037; UNQ3037/PRO9852
• Common Name: SUMF1
• Gene Symbol: SUMF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining