Invitrogen™ Human SULT2B1 (aa 192-269) Control Fragment Recombinant Protein

Product Code. 30180879

Brand: Invitrogen™ RP98895

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59696 (PA5-59696. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytosolic sulfotransferases (STs or SULTs) catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. Her et al. (1998) identified an EST with homology to ST enzymes. By PCR with human placental and prostate cDNA as template, they isolated 2 alternatively spliced cDNAs, identical throughout most of their sequences, but having different 5-prime ends. The shorter cDNA, SULT2B1a, encodes a protein of 350 amino acids; the longer cDNA, SULT2B1b, encodes a 365-amino acid protein. Genomic PCR analysis revealed that the gene encoding both cDNAs, SULT2B1, contains 7 exons, with 2 alternative first exons being used to generate SULT2B1a and SULT2B1b. Northern blot analysis revealed that the SULT2B1 gene is expressed as a 1.4-kb transcript predominantly in prostate, placenta, and trachea.

Specifications

• Accession Number: O00204
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6820
• Name: Human SULT2B1 (aa 192-269) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI326997; alcohol sulfotransferase; BB173635; HSST2; Hydroxysteroid sulfotransferase 2; RGD:1308882}; ST2B1; sulfotransferase 2 B; sulfotransferase 2B1; Sulfotransferase family 2 B member 1; sulfotransferase family cytosolic 2 B member 1; sulfotransferase family, cytosolic, 2 B, member 1; SULT2B; Sult2b1; sult2b1 {ECO:0000312; SULT2B1a
• Common Name: SULT2B1
• Gene Symbol: SULT2B1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining