Invitrogen™ Human SUGCT (aa 246-370) Control Fragment Recombinant Protein

Product Code. 30206892

Brand: Invitrogen™ RP92801

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55385 (PA5-55385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SUGCT (Succinyl-CoA:Glutarate-CoA Transferase) is a Protein Coding gene. Diseases associated with SUGCT include Glutaric Aciduria Iii and Noonan Syndrome 8. Gene Ontology (GO) annotations related to this gene include succinate-hydroxymethylglutarate CoA-transferase activity. An important paralog of this gene is AMACR.

Specifications

• Accession Number: Q9HAC7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79783
• Name: Human SUGCT (aa 246-370) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5033411D12Rik; C18H7orf10; C22orf6; C4H7orf10; C7orf10; D17907; dermal papilla derived protein 13; dermal papilla-derived protein 13; DERP13; GA3; hypothetical protein LOC619244; KIAA1186; KIAA1658; LOW QUALITY PROTEIN: succinate--hydroxymethylglutarate CoA-transferase; ORF19; RGD1308114; Russel-Silver syndrome candidate; succinate--hydroxymethylglutarate CoA-transferase; succinyl-CoA glutarate-CoA transferase; succinyl-CoA:glutarate-CoA transferase; succinylCoA:glutarate-CoA transferase; SUGCT; zgc:113390
• Common Name: SUGCT
• Gene Symbol: Sugct
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQVACLSHIAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYIVVGAGNNQQFATVCKILDLPELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFEGSGVPYGPINNMKNVFAEPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining