Invitrogen™ Human SUCLG2 (aa 221-294) Control Fragment Recombinant Protein

Product Code. 30180518

Brand: Invitrogen™ RP99909

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62527 (PA5-62527. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a GTP-specific beta subunit of succinyl-CoA synthetase. Succinyl-CoA synthetase catalyzes the reversible reaction involving the formation of succinyl-CoA and succinate. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 5 and 12.

Specifications

• Accession Number: Q96I99
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8801
• Name: Human SUCLG2 (aa 221-294) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AF171077; AW556404; D6Wsu120e; GBETA; G-BETA; G-SCS; GTPSCS; GTP-specific succinyl-CoA synthetase beta subunit; GTP-specific succinyl-CoA synthetase subunit beta; hypothetical protein LOC537713; SCS-betaG; Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial; succinate-CoA ligase GDP-forming beta subunit; succinate-CoA ligase GDP-forming subunit beta; succinate-CoA ligase, GDP-forming, beta subunit; succinate-Coenzyme A ligase, GDP-forming, beta subunit; succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial; succinyl-CoA ligase, GDP-forming, beta chain, mitochondrial; succinyl-CoA synthetase beta-G chain; succinyl-CoA synthetase, beta-G chain; Suclg2
• Common Name: SUCLG2
• Gene Symbol: SUCLG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining