Invitrogen™ Human SUCLA2 (aa 207-301) Control Fragment Recombinant Protein

Product Code. 30196031

Brand: Invitrogen™ RP107076

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66400 (PA5-66400. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit.

Specifications

• Accession Number: Q9P2R7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8803
• Name: Human SUCLA2 (aa 207-301) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930547K18Rik; A-BETA; A-SCS; ATP-specific succinyl-CoA synthetase subunit beta; ATP-specific succinyl-CoA synthetase, beta subunit; mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta; MTDPS5; renal carcinoma antigen NY-REN-39; RP11-528D24.2; SCSbetaA; SCS-betaA; succinate--CoA ligase (ADP-forming); Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial; succinate-CoA ligase ADP-forming beta subunit; succinate-CoA ligase beta subunit; succinate-CoA ligase, ADP-forming, beta subunit; succinate-Coenzyme A ligase, ADP-forming, beta subunit; succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial; succinyl-CoA synthetase beta-A chain; Sucla2
• Common Name: SUCLA2
• Gene Symbol: SUCLA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining