Invitrogen™ Human STXBP3 (aa 23-119) Control Fragment Recombinant Protein

Product Code. 30205032

Brand: Invitrogen™ RP94070

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55549 (PA5-55549. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: O00186
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6814
• Name: Human STXBP3 (aa 23-119) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Mammalian homolog of Unc-18 c; MUNC-18-3; MUNC18-3; MUNC18C; Munc-18 c; Munc18-c; Platelet Sec1 protein; protein unc-18 homolog 3; Protein unc-18 homolog C; PSP; Stxbp3; Stxbp3a; Sxtbp3; syntaxin 4 binding protein; syntaxin binding protein 3; syntaxin binding protein 3 A; syntaxin-binding protein 3; Syntaxin-BP3; unc-18 homolog 3; Unc18-3; Unc18c; unc-18 C
• Common Name: STXBP3
• Gene Symbol: STXBP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining