missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199212

Invitrogen™ Human STS1 (aa 507-603) Control Fragment Recombinant Protein

Product Code. 30199212
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199212

Brand: Invitrogen™ RP97394

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sts1 encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TF42
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84959
Name Human STS1 (aa 507-603) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810457I06Rik; BB125008; Cbl-interacting protein p70; Cbl-interacting protein Sts-1; KIAA1959; MGC15437; nm23-phosphorylated unknown substrate; p70; RGD1310357; SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling 1, nm23-phosphorylated unknown substrate; STS1; STS-1; suppressor of T-cell receptor signaling 1; T-cell ubiquitin ligand 2; TULA2; TULA-2; tyrosine-protein phosphatase STS1/TULA2; UBASH3B; ubiquitin associated and SH3 domain containing B; ubiquitin associated and SH3 domain containing, B; ubiquitin-associated and SH3 domain-containing protein B
Common Name STS1
Gene Symbol UBASH3B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.