Invitrogen™ Human STRAP (aa 182-267) Control Fragment Recombinant Protein

Product Code. 30204622

Brand: Invitrogen™ RP103219

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63146 (PA5-63146. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STRAP is a 350 amino acid MAP activator with WD-40 repeats that is localized both in the cytoplasm and the nucleus. It is a ubiquitously expressed protein that acts as an inhibitor of TGF-beta signaling and an important regulator of cell proliferation. Stable expression of STRAP results in activation of the mitogen-activated protein kinase/extracellular signal-regulated kinase pathway and in down-regulation of the cyclin-dependent kinase inhibitor p21 (Cip1), which results in retinoblastoma protein hyperphosphorylation. Upregulation of STRAP might play a role in tumor development as an early event for colorectal cancers. It is the first component of the U snRNP assembly machinery that associates with SMN complex in a compartment-specific way and plays a crucial role in the intracellular distribution of SMN1.

Specifications

• Accession Number: Q9Y3F4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11171
• Name: Human STRAP (aa 182-267) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW557906; C78091; C79202; MAP activator with WD repeats; MAWD; PT-WD; serine/threonine kinase receptor associated protein; Serine-threonine kinase receptor-associated protein; STRAP; UNR-interacting protein; UNRIP; WD-40 repeat protein PT-WD
• Common Name: STRAP
• Gene Symbol: Strap
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining