Invitrogen™ Human STK32A (aa 224-300) Control Fragment Recombinant Protein

Product Code. 30207554

Brand: Invitrogen™ RP97248

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59115 (PA5-59115. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK32A (serine/threonine kinase 32A), also known as YANK1, is a 396 amino acid protein that belongs to the superfamily of serine/threonine protein kinases and exists as three isoforms. The gene encoding STK32A maps to human chromosome 5, which is associated with Cockayne syndrome through the ERCC8 gene and familial adenomatous polyposis through the adenomatous polyposis coli (APC) tumor suppressor gene. Treacher Collins syndrome is also chromosome 5 associated and is caused by insertions or deletions within the TCOF1 gene.

Specifications

• Accession Number: Q8WU08
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 202374
• Name: Human STK32A (aa 224-300) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930015B13Rik; CTB-108O6.2; serine/threonine kinase 32 A; serine/threonine-protein kinase 32 A; Stk32a; YANK1; Yet another novel kinase 1
• Common Name: STK32A
• Gene Symbol: STK32A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining