Invitrogen™ Human STK19 (aa 38-111) Control Fragment Recombinant Protein

Artikelnummer. 30196628

missing translation for 'mfr': Invitrogen™ RP107640

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66998 (PA5-66998. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants.

Spezifikation

• Accession Number: P49842
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8859
• Name: Human STK19 (aa 38-111) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D6S60; D6S60E; G11; HLA-RP1; MHC class III HLA-RP1; nuclear serine/threonine protein kinase; Protein G11; Protein RP1; RP1; serine/threonine kinase 19; serine/threonine-protein kinase 19; Stk19
• Common Name: STK19
• Gene Symbol: STK19
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining